Protein Info for EX28DRAFT_0348 in Enterobacter asburiae PDN3

Annotation: glycerol-3-phosphate dehydrogenase, anaerobic, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03378: glycerol-3-phosphate dehydrogenase, anaerobic, B subunit" amino acids 3 to 397 (395 residues), 493.3 bits, see alignment E=3.1e-152 PF00890: FAD_binding_2" amino acids 4 to 385 (382 residues), 220.5 bits, see alignment E=7.1e-69

Best Hits

Swiss-Prot: 78% identical to GLPB_ENT38: Anaerobic glycerol-3-phosphate dehydrogenase subunit B (glpB) from Enterobacter sp. (strain 638)

KEGG orthology group: K00112, glycerol-3-phosphate dehydrogenase subunit B [EC: 1.1.5.3] (inferred from 91% identity to enc:ECL_03534)

MetaCyc: 67% identical to anaerobic glycerol-3-phosphate dehydrogenase subunit B (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase. [EC: 1.1.5.3]

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit B (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>EX28DRAFT_0348 glycerol-3-phosphate dehydrogenase, anaerobic, B subunit (Enterobacter asburiae PDN3)
MKFDTVIVGGGLAGLLCGIKLSKQGLRCAIITCGQSALHFSSGSLDLVDEAYRDKLPPEH
PYHLIGAQHIDRFALETEALLADCGARLKGSARLNHQRVTPLGTLRSAWLSPEEVPVAPF
NAGRVRVVGISGFLDFQPHLAAASLCRQSVKAETAEIELPELDVLRDNPSEFRAVNIARF
LDNEDKWPLLYDALRPLSDGCDALLMPACFGLRDNRLWRWLSDHLPCSLGLLPTLPPSVP
GIRLHTQLQRQFVAQGGVWMAGDEVKKITLTDGAVSEIWTRNHDDIPLRARYTVLASGSF
FSNGLLSSREGIREAIMGLDVRQRASRADWYQSDFFSPQPWQQFGVIVDSQLHPQLSGKP
VSNLFAIGSLLGGYDPIAQGCGGGVCAVTALYVAEQISQRTEAEQ