Protein Info for EX28DRAFT_0342 in Enterobacter asburiae PDN3

Annotation: 1,4-Dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR01929: naphthoate synthase" amino acids 22 to 281 (260 residues), 497.4 bits, see alignment E=4.7e-154 PF00378: ECH_1" amino acids 32 to 279 (248 residues), 271.2 bits, see alignment E=8e-85 PF16113: ECH_2" amino acids 35 to 212 (178 residues), 83.5 bits, see alignment E=2.2e-27

Best Hits

Swiss-Prot: 95% identical to MENB_SALTY: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 100% identity to enc:ECL_03612)

MetaCyc: 94% identical to 1,4-dihydroxy-2-naphthoyl-CoA synthase (Escherichia coli K-12 substr. MG1655)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>EX28DRAFT_0342 1,4-Dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) (Enterobacter asburiae PDN3)
MIYPDENMLYAPVEWQDCSEGYTDIRYHKSADGIAKITINRPQVRNAFRPLTVKEMIQAL
ADARYDDNIGVIVLTGEGDKAFCSGGDQKVRGDYGGYQDDAGTHHLNVLDFQRQIRTCPK
PVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGGWGASYMARIVGQKKA
REIWFLCRQYNAQEALDMGLVNTVVPIADLEKETVRWCREMLQNSPMALRCLKAALNADC
DGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRQPDFSKYKRNP