Protein Info for EX28DRAFT_0341 in Enterobacter asburiae PDN3

Annotation: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  • amino acids 15 to 250 (236 residues), 255.6 bits, E=2.4e-80
• PF00561: Abhydrolase_1
  • amino acids 15 to 239 (225 residues), 65.9 bits, E=4.7e-22
• PF12697: Abhydrolase_6
  • amino acids 17 to 244 (228 residues), 67.9 bits, E=2.1e-22

Best Hits

Swiss-Prot: 69% identical to MENH_ENT38: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Enterobacter sp. (strain 638)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 79% identity to enc:ECL_03613)

MetaCyc: 70% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Protein Sequence (258 amino acids)

>EX28DRAFT_0341 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Enterobacter asburiae PDN3)
MILSGVQQAGKPGYPLLVFLHGFSGDRREWQRVGEGFSDYPRLYLDLPGHGGSRNLGVTG
FDEMSALLTRTLLSYNILKFWLIGYSLGGRIAMFHASQQPKGLLGMIVEGGHPGLQDADA
RNARLASDRRWATRFRTEPLDKVFADWYQQPVFASLTDAQREALITLRSQNNGETLAMML
EATSLAVQPDLRAALSARDFSFDYLYGERDEKFAALAAEVNAVCHAIPDAGHNAHRENPD
AVIASLAQILRYRIKDTL