Protein Info for EX28DRAFT_0328 in Enterobacter asburiae PDN3

Annotation: NADH:ubiquinone oxidoreductase subunit 1 (chain H)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF00146: NADHdh" amino acids 17 to 317 (301 residues), 401.2 bits, see alignment E=1.5e-124

Best Hits

Swiss-Prot: 99% identical to NUOH_ENT38: NADH-quinone oxidoreductase subunit H (nuoH) from Enterobacter sp. (strain 638)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to enc:ECL_03626)

MetaCyc: 95% identical to NADH:quinone oxidoreductase subunit H (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>EX28DRAFT_0328 NADH:ubiquinone oxidoreductase subunit 1 (chain H) (Enterobacter asburiae PDN3)
MSWLTPDLIDILLSILKAIVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQL
VADMIKMFFKEDWIPRFSDRVIFTLAPMIAFTSLLLAFAIVPVSPTWVVADLNIGILFFL
MMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLSLMGVVAQAGSFNMTDIV
NNQADIWNVIPQFFGFITFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVG
EYIGIVTISALMVTLFFGGWHGPFLPPFIWFALKTAFFMMMFILIRAALPRPRYDQVMSF
GWKVCLPLTLVNLLVTAAVILWQQP