Protein Info for EX28DRAFT_0325 in Enterobacter asburiae PDN3

Annotation: NADH-quinone oxidoreductase, F subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 13 to 423 (411 residues), 679.2 bits, see alignment E=7e-209 PF01512: Complex1_51K" amino acids 54 to 226 (173 residues), 166.9 bits, see alignment E=3e-53 PF10589: NADH_4Fe-4S" amino acids 338 to 421 (84 residues), 99.9 bits, see alignment E=6e-33

Best Hits

Swiss-Prot: 95% identical to NUOF_SALTY: NADH-quinone oxidoreductase subunit F (nuoF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 100% identity to enc:ECL_03628)

MetaCyc: 95% identical to NADH:quinone oxidoreductase subunit F (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>EX28DRAFT_0325 NADH-quinone oxidoreductase, F subunit (Enterobacter asburiae PDN3)
MKTVIRTAETHPLTWRLRDDKQPVWLDEYQSKNGYAGARKALGGMAPDDIVNAVKDSGLK
GRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISA
FALKAYRGYIFLRGEYIEAAENLRRAIAEATEAGLLGKNILGTGFDFELFVHTGAGRYIC
GEETALINSLEGRRANPRSKPPFPASSGVWGKPTCVNNVETLCNVPAILANGVEWYQGIS
SSKDAGTKLMGFSGRVKNPGVWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEIGMVSLVRNLEEFFARESCGWCTPCRDG
LPWSVKILRAIERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFRDEFE
AGIKQPFSNTHAINGIQPNLLKARW