Protein Info for EX28DRAFT_0296 in Enterobacter asburiae PDN3

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 114 (107 residues), 69.6 bits, see alignment E=1.4e-23 PF00528: BPD_transp_1" amino acids 28 to 220 (193 residues), 93.7 bits, see alignment E=5.9e-31

Best Hits

Swiss-Prot: 92% identical to HISQ_SALTY: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 100% identity to enc:ECL_03657)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>EX28DRAFT_0296 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Enterobacter asburiae PDN3)
MLYGFSGVILQGALVTLELAISSVVLAVLIGLAGAGAKLSANKPLALIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNSVTDAMGMGQIDIDPMVAGIITLGFIYGAYFTETFRGAYMAVP
KGHIEAATAFGFTSSQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGVIYLVFTTVSNGVLLLLERRYSVGVKRADL