Protein Info for EX28DRAFT_0243 in Enterobacter asburiae PDN3

Annotation: type VI secretion protein, EvpB/VC_A0108 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR03355: type VI secretion protein, EvpB/VC_A0108 family" amino acids 45 to 508 (464 residues), 675.1 bits, see alignment E=3e-207 PF05943: VipB" amino acids 87 to 387 (301 residues), 418.3 bits, see alignment E=1.6e-129 PF18945: VipB_2" amino acids 397 to 507 (111 residues), 135.6 bits, see alignment E=8.7e-44

Best Hits

KEGG orthology group: K11900, type VI secretion system protein ImpC (inferred from 96% identity to ses:SARI_02733)

Predicted SEED Role

"Uncharacterized protein ImpC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>EX28DRAFT_0243 type VI secretion protein, EvpB/VC_A0108 family (Enterobacter asburiae PDN3)
MSVQNNIAGSESVVLERPAAGGVYASLFEKINLSPVSELSALDLWQDAQAMSDATADERL
TAGMQVFLECLTKAGAKVEKLDKSLIDHHIAELDYQISRQLDAVMHHDEFQAVESLWRGV
KSLVDKTDFRQNVKIELLSMSKEDLRQDFEDSPEIIQSGLYKHAYIDEYDTPGGEPIAAL
ISAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPKFFLKESMEDVAAIKDIGNYFDRA
EYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDKYLWTNAS
FAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREFE
FANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPG
FFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKS