Protein Info for EX28DRAFT_0232 in Enterobacter asburiae PDN3

Annotation: NRAMP (natural resistance-associated macrophage protein) metal ion transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 284 to 312 (29 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 20 to 377 (358 residues), 332.4 bits, see alignment E=2.3e-103 PF01566: Nramp" amino acids 25 to 406 (382 residues), 463.6 bits, see alignment E=2.8e-143

Best Hits

Swiss-Prot: 94% identical to MNTH_ENT38: Divalent metal cation transporter MntH (mntH) from Enterobacter sp. (strain 638)

KEGG orthology group: K03322, manganese transport protein (inferred from 93% identity to eco:b2392)

MetaCyc: 93% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>EX28DRAFT_0232 NRAMP (natural resistance-associated macrophage protein) metal ion transporters (Enterobacter asburiae PDN3)
MTNSRVEGSSGRAARKLRFALMGPAFIAAIGYIDPGNFATNIQAGASFGYKLLWVVVWAN
MMAMLIQMLSAKLGIATGKNLAEQIRDHYPRPAVWLYWVQAEIIAMATDLAEFIGAAIGF
KLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELIFSQPNLA
QLGKGMVIPSLPTSEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGTRKERYSATKWDVA
IAMTIAGFVNLAMMATAAAAFHFNGHTGIADLDQAYLTLEPLLSHAAATIFGLSLVAAGL
SSTVVGTLAGQVVMQGFVRFHIPLWVRRSVTMLPSFIVILMGLDPTRILVMSQVLLSFGI
ALALVPLLIFTSNKTLMGELVNSTLVKRTGWAIVVVVVALNLWLLIGTALGL