Protein Info for EX28DRAFT_0225 in Enterobacter asburiae PDN3

Annotation: glutamyl-tRNA synthetase, bacterial family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to SYE_ENT38: Glutamate--tRNA ligase (gltX) from Enterobacter sp. (strain 638)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 98% identity to enc:ECL_03736)

MetaCyc: 91% identical to glutamate--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--tRNA ligase. [EC: 6.1.1.17]

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

tRNA charging (21/21 steps found)
superpathway of heme b biosynthesis from glutamate (10/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>EX28DRAFT_0225 glutamyl-tRNA synthetase, bacterial family (Enterobacter asburiae PDN3)
MKIKTRFAPSPTGYLHVGGARTALYSWLFARHNKGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLNLEWDEGPYFQTKRFDRYNAVIDEMLVAGTAYKCYCSKERLDELREAQMANGEKPR
YDGRCRHDHSEHAADEPCVVRFANPQEGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMEITHVVRGEDHINNTPRQINILKALNAPVPVYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWAHGDQEIFSREEMIELFSLSSVSKSASAFNT
DKLLWLNHHYINTMQPEYVATYLQWHIEQAKIDTRTGPELADLVKLLGERCKTLKEIAES
CRYFYEEFDEFDADAAKKHLRPVARQPLEVVRDKLAALSEWTAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSVARINKALDFIAERENQQ