Protein Info for EX28DRAFT_0197 in Enterobacter asburiae PDN3

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00874: transaldolase" amino acids 2 to 316 (315 residues), 531.1 bits, see alignment E=5.3e-164 PF00923: TAL_FSA" amino acids 13 to 310 (298 residues), 332.7 bits, see alignment E=9.9e-104

Best Hits

Swiss-Prot: 85% identical to TALA_SALTI: Transaldolase A (talA) from Salmonella typhi

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 97% identity to enc:ECL_03761)

MetaCyc: 63% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>EX28DRAFT_0197 transaldolase (Enterobacter asburiae PDN3)
MNQLDGIKKFTTVVADSGDIESIRHYQPEDATTNPSLLLKAAGLAHFSHLIDDAIAYGKQ
RGKTQEQQVAEASDKLAVNFGAEILKSIPGRVSTEVDARLSFDKEKSINKARRLVELYEE
QGIDKSRILIKLASTWEGIRAAEVLEKEGIHCNLTLLFSFAQARACAEAGVFLVSPFVGR
IYDWYQAKQPMDPYVVDEDPGVKSVRNIYDYYKQHRYETIVMGASFRRTEQILALAGCDR
LTISPNLLQELQDKEETVIRKLVPTSTVLPKPKAMTEAEFRWEHNQDAMAVEKLADGIRQ
FAVDQRKLEDLLAAKL