Protein Info for EX28DRAFT_0161 in Enterobacter asburiae PDN3

Annotation: Cyanate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 19 to 35 (17 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 307 (284 residues), 58.2 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to kpu:KP1_4083)

Predicted SEED Role

"FIG00732137: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>EX28DRAFT_0161 Cyanate permease (Enterobacter asburiae PDN3)
METPALPRRLALTAGCNQLINWGISFYMPGTFALAISADRGWSSPQIYLGLTLAMLVMAA
VSPFVARLLARFGGQTVVMSGTLLIAASCAGMAYTQTLFGWYCAWLFNGIGMRLSLYDAL
FAALVNLYGQQARRTISRVTLAGGLASAVFWPLGDALLQVMSWQEALRVYALFGLLSAML
IRTLPRQRLTVTTMVAAPPLNNERRNAWLYAAFIALITFVSNGTSTHLPEFIAHFGLPVA
IGMLWGVGQTGARSLEVLAGARLTPFKLTLFTALAMPLCFLLGTSSALFMWCAAGFVLGY
GAINGLVTIVKATLPLELFSTESYARRTGMLLIPGQLMAAASPFAYAWLNKTLGIAGAMW
VSTGLTLVIAGLAIAIVRRPCRQTVSHCIQSATLTNGYKTPPPANISDT