Protein Info for EX28DRAFT_0156 in Enterobacter asburiae PDN3

Annotation: Uncharacterized enzyme involved in inositol metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF04962: KduI" amino acids 10 to 264 (255 residues), 372.8 bits, see alignment E=4.4e-116 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 19 to 264 (246 residues), 327.8 bits, see alignment E=2.3e-102

Best Hits

Swiss-Prot: 60% identical to IOLB_GEOTN: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 95% identity to enc:ECL_03800)

MetaCyc: 48% identical to 5-deoxy-D-glucuronate isomerase (Bacillus subtilis subtilis 168)
RXN-14150 [EC: 5.3.1.30]

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>EX28DRAFT_0156 Uncharacterized enzyme involved in inositol metabolism (Enterobacter asburiae PDN3)
MSRLLSRWQQPNAEGRTQSVTPESAGWGYVGFEAYELQEGQTLTLPAVSEERCLVLVAGR
ASIRTPSAQFNDIGERMSPFERIKPWAVYVAPQETVQVKALTKLELAVCAAPGKGTYPTR
LIAPQDIDGEARGKGNNQRYVHNILPEDRPADSLLVVEVWTSEGCTSSYPSHKHDTDNPP
QETYLEETYYHRLNPEQGFCMQRVYTDDRTLDECMAVYNRDVVMVPKGYHPVATMAGYDS
YYLNVMAGPVRKWMFTWEEDHAWINRDYPADSGG