Protein Info for EX28DRAFT_0131 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details PF09976: TPR_21" amino acids 15 to 205 (191 residues), 176.4 bits, see alignment E=2.9e-56

Best Hits

Swiss-Prot: 78% identical to YFGM_ECOLI: UPF0070 protein YfgM (yfgM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_03855)

Predicted SEED Role

"Mlr7403 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>EX28DRAFT_0131 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MEIYENEHDQVDAIKRFFVENGKALVVGVILGVGALVGWRYWNNHQADSARGASLSYETT
VSAIRADQPQTLAAAEKFAADNKNTYGALAALEVAQQYVDKNELDKAAAQLSQSLAAASD
ENLKAVINLRLARIQVQQKKADDALKTLDTIKGEGFAAIVADLRGEALLSKGDKAGARKA
WQAGVESNASPALSEMMQMKINNLSV