Protein Info for EX28DRAFT_0082 in Enterobacter asburiae PDN3

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF03740: PdxJ" amino acids 6 to 238 (233 residues), 367.7 bits, see alignment E=9.2e-115 TIGR00559: pyridoxine 5'-phosphate synthase" amino acids 6 to 239 (234 residues), 376.8 bits, see alignment E=2.2e-117

Best Hits

Swiss-Prot: 93% identical to PDXJ_ECO57: Pyridoxine 5'-phosphate synthase (pdxJ) from Escherichia coli O157:H7

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 97% identity to enc:ECL_03902)

MetaCyc: 93% identical to pyridoxine 5'-phosphate synthase (Escherichia coli K-12 substr. MG1655)
Pyridoxine 5'-phosphate synthase. [EC: 2.6.99.2]

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>EX28DRAFT_0082 pyridoxine 5'-phosphate synthase (Enterobacter asburiae PDN3)
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRI
LRQTLDTRMNLEMAVTEEMLAIACETQPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC
KRLADAGILVSLFIDADFAQIKAAADVGAPYIEIHTGCYADAKNDAEQAKELERIAKAAT
YASSLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKRLMQE
ARQ