Protein Info for EX28DRAFT_0037 in Enterobacter asburiae PDN3

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 132 (130 residues), 198.8 bits, see alignment E=1.6e-63 PF01741: MscL" amino acids 3 to 130 (128 residues), 161.2 bits, see alignment E=7.2e-52

Best Hits

Swiss-Prot: 96% identical to MSCL_CITK8: Large-conductance mechanosensitive channel (mscL) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 97% identity to enc:ECL_04667)

MetaCyc: 95% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>EX28DRAFT_0037 large conductance mechanosensitive channel protein (Enterobacter asburiae PDN3)
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT
LREAQGDVPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNRKKEEPAAAPAPTKEEV
LLSEIRDLLKEQNNRV