Protein Info for EX28DRAFT_0004 in Enterobacter asburiae PDN3

Annotation: Type IV leader peptidase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 57 (13 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 108 to 136 (29 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details signal peptide" amino acids 33 to 33 (1 residues), see Phobius details PF01478: Peptidase_A24" amino acids 23 to 128 (106 residues), 71.7 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 58% identical to HOPD_ECOLX: Leader peptidase HopD (hopD) from Escherichia coli

KEGG orthology group: K02506, leader peptidase HopD [EC: 3.4.23.43] (inferred from 76% identity to enc:ECL_04699)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>EX28DRAFT_0004 Type IV leader peptidase family (Enterobacter asburiae PDN3)
MTSMRSNPFEAISMLTTLPFLLVYFSLTAFLVRADIRYGLLPDKFLCPLLWTGLLFQLCI
QPDFLPSAVVGAMAGYIGFAVIYWGYRFICRREGMGYGDVKYLAALGAWHGWCVLPALAL
LAALMALLSILVFSLLTGDKGALKNPLPFGPFLAAAGLCVGWKTVVTLPL