Protein Info for EFB2_04630 in Escherichia fergusonii Becca

Annotation: Protein translocase subunit SecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details TIGR00964: preprotein translocase, SecE subunit" amino acids 69 to 123 (55 residues), 59.8 bits, see alignment E=9.2e-21 PF00584: SecE" amino acids 70 to 122 (53 residues), 70.7 bits, see alignment E=4e-24

Best Hits

Swiss-Prot: 100% identical to SECE_ECOL6: Protein translocase subunit SecE (secE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to eco:b3981)

MetaCyc: 100% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>EFB2_04630 Protein translocase subunit SecE (Escherichia fergusonii Becca)
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF