Protein Info for EFB2_04481 in Escherichia fergusonii Becca

Annotation: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR03293: phosphonate C-P lyase system protein PhnG" amino acids 6 to 148 (143 residues), 180.2 bits, see alignment E=1.1e-57 PF06754: PhnG" amino acids 7 to 147 (141 residues), 178.7 bits, see alignment E=3.2e-57

Best Hits

Swiss-Prot: 97% identical to PHNG_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (phnG) from Escherichia coli (strain K12)

KEGG orthology group: K06166, PhnG protein (inferred from 100% identity to ecc:c5107)

MetaCyc: 97% identical to carbon-phosphorus lyase core complex subunit PhnG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PhnG protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>EFB2_04481 Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (Escherichia fergusonii Becca)
MHADTATRQHWMSVLAHSQPAELAARLNALNINADYEVIRAAETGLVQIQARMGGTGERF
FAGDATLTRAAVRLTDGTLGYSWVLGRDKQHAERCALIDALMQQNRHFQNLSETLITPLD
ADRMARIAARQAEVNASRVDFFTMVRGDNA