Protein Info for EFB2_03633 in Escherichia fergusonii Becca

Annotation: Protein/nucleic acid deglycase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 4 to 170 (167 residues), 168.4 bits, see alignment E=6.3e-54 TIGR01383: DJ-1 family protein" amino acids 5 to 183 (179 residues), 222.6 bits, see alignment E=1.6e-70

Best Hits

Swiss-Prot: 100% identical to YAJL_ECOLI: Protein/nucleic acid deglycase 3 (yajL) from Escherichia coli (strain K12)

KEGG orthology group: K03152, 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis (inferred from 100% identity to eco:b0424)

MetaCyc: 100% identical to protein/nucleic acid deglycase 3 (Escherichia coli K-12 substr. MG1655)
4.2.1.-; RXN-17632 [EC: 3.5.1.124]

Predicted SEED Role

"DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.124

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>EFB2_03633 Protein/nucleic acid deglycase 3 (Escherichia fergusonii Becca)
MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLV
EVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFP
IGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHE
VASQLVMAAGIYNYYE