Protein Info for EFB2_02251 in Escherichia fergusonii Becca

Annotation: Protein Ves

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF05962: HutD" amino acids 7 to 175 (169 residues), 145 bits, see alignment E=1.4e-46

Best Hits

Swiss-Prot: 100% identical to VES_ECOUT: Protein Ves (ves) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K09975, hypothetical protein (inferred from 97% identity to eco:b1742)

Predicted SEED Role

"Conserved hypothetical protein (perhaps related to histidine degradation)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>EFB2_02251 Protein Ves (Escherichia fergusonii Becca)
MEYFDMRKMSVNLWRNAAGETREICTFPPAKRDFYWRASITSIAANGEFSLFPGMERIVT
LLEGGEMFLESADRFNHTLKPLQPFSFAADLVVKAKLTAGQMSMDFNIMTRLDVCKAKVR
IAERTFTTFGSRGGVVFVINGAWQLGDKLLTTDQGACWFDGRHTLRLLQPQGKLLFSEIN
WLAGHSPDQVQ