Protein Info for EFB2_02033 in Escherichia fergusonii Becca

Annotation: UvrABC system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 TIGR00194: excinuclease ABC subunit C" amino acids 9 to 589 (581 residues), 799.3 bits, see alignment E=1.1e-244 PF01541: GIY-YIG" amino acids 18 to 93 (76 residues), 41.1 bits, see alignment E=5.5e-14 PF02151: UVR" amino acids 205 to 237 (33 residues), 39 bits, see alignment (E = 1.5e-13) PF22920: UvrC_RNaseH" amino acids 251 to 368 (118 residues), 123.5 bits, see alignment E=1.3e-39 PF08459: UvrC_RNaseH_dom" amino acids 385 to 542 (158 residues), 163.8 bits, see alignment E=9.1e-52 PF14520: HHH_5" amino acids 557 to 608 (52 residues), 34.4 bits, see alignment 7.5e-12 PF00633: HHH" amino acids 579 to 606 (28 residues), 27.5 bits, see alignment (E = 6.1e-10)

Best Hits

Swiss-Prot: 100% identical to UVRC_ECO5E: UvrABC system protein C (uvrC) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to eco:b1913)

MetaCyc: 100% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>EFB2_02033 UvrABC system protein C (Escherichia fergusonii Becca)
MSDQFDAKAFLKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALV
AQIQQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSGDTHPRLAMHRG
AKHAKGEYFGPFPNGYAVRETLALLQKIFPIRQCENSVYRNRSRPCLQYQIGRCLGPCVE
GLVSEEEYAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVT
EKQFVSNTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFV
GQFYLQGSQMRTLPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLART
NAATALTSKLSQQSTVHQRLTALASVLKLPEVKRMECFDISHTMGEQTVASCVVFDANGP
LRAEYRRYNITGITPGDDYAAMNQVLRRRYGKAIDDSKIPDVILIDGGKGQLAQAKNVFA
ELDVSWDKNHPLLLGVAKGADRKAGLETLFFEPEGEGFSLPPDSPALHVIQHIRDESHDH
AIGGHRKKRAKVKNTSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
AEKIFWSLKH