Protein Info for EFB2_01787 in Escherichia fergusonii Becca

Annotation: putative diguanylate cyclase DgcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1105 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 212 to 228 (17 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF05231: MASE1" amino acids 19 to 294 (276 residues), 123.7 bits, see alignment E=3.6e-39 TIGR00229: PAS domain S-box protein" amino acids 299 to 422 (124 residues), 118.4 bits, see alignment E=2.2e-38 amino acids 553 to 676 (124 residues), 47.1 bits, see alignment E=2.4e-16 PF00989: PAS" amino acids 303 to 414 (112 residues), 36 bits, see alignment E=2.5e-12 amino acids 560 to 668 (109 residues), 32.3 bits, see alignment E=3.6e-11 PF08448: PAS_4" amino acids 314 to 419 (106 residues), 27.7 bits, see alignment E=1.1e-09 amino acids 561 to 672 (112 residues), 41.2 bits, see alignment E=6.9e-14 PF13426: PAS_9" amino acids 314 to 416 (103 residues), 41.9 bits, see alignment E=4.2e-14 amino acids 566 to 670 (105 residues), 31.2 bits, see alignment E=9.1e-11 PF08447: PAS_3" amino acids 328 to 408 (81 residues), 39.4 bits, see alignment 2.5e-13 amino acids 452 to 537 (86 residues), 38.7 bits, see alignment 4e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 680 to 842 (163 residues), 126.1 bits, see alignment E=1.2e-40 PF00990: GGDEF" amino acids 682 to 838 (157 residues), 154.7 bits, see alignment E=7.5e-49 PF00563: EAL" amino acids 900 to 1089 (190 residues), 66.3 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 98% identical to DGCE_ECOLI: Probable diguanylate cyclase DgcE (dgcE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b2067)

Predicted SEED Role

"FIG00639031: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1105 amino acids)

>EFB2_01787 putative diguanylate cyclase DgcE (Escherichia fergusonii Becca)
MSKQSQHVLIALPHPLLHLVSLGLVSFIFTLFSLELSQFGTQLAPLWFPTSIMMVAFYRH
AGRMWPGIALSCSLGNIAASILLFSTSSLNMTWTTINIVEAVVGAVLLRKLLPWYNPLQN
LADWLRLALGSAIIPPLLGGVLVVLLTPGDDPLRAFLIWVLSESIGALALVPLGLLFKPH
YLLRHRNPRLLFESLLTLAITLTLSWLSMLYLPWPFTFIIVLLMWSAVRLPRMEAFLIFL
TTVMMVSLMMAADPSLLATPRTYLMSHMPWLPFLLILLPANIMTMVMYAFRAERKHISES
ETRFRNAMEYSAIGMALVGTEGQWLQSNKALCQFLGYSQEELRGLTFQQLTWPEDLNKDL
QQVEKLISGEINTYSMEKRYYNRNGDVVWALLAVSLVRHTDGTPLYFIAQIEDINELKRT
EQVNQQLMERITLANEAGGIGIWEWELKPNIFSWDKRMFELYEIPPHIKPNWQVWYECVL
PEDRQHAEKVIRDSLQSRSPFKLEFRITVKDGIRHIRALANRVLNKEGEVERLLGINMDM
TEVKQLNEALFQEKERLHITLDSIGEAVVCIDMAMKITFMNPVAEKMSGWTQEEALGVPL
LTVLHITFGDNGPLMENIYSADTSRSAIEQDVVLHCRSGGSYDVHYSITPLSTLDGSNIG
SVLVIQDVTESRKMLRQLSYSASHDALTHLANRASFEKQLRILLQTVNSTHQRHALVFID
LDRFKAVNDSAGHAAGDALLRELASLMLSMLRSSDVLARLGGDEFGLLLPDCNVESARFI
ATRIISAVNDYHFIWEGRVHRVGASAGITLIDDNNHQAAEVMSQADIACYASKNGGRGRV
TIYEPQQAAAHSERAAISLDEQWRMIKENQLMMIAHGIASPRLPEASNLWLISLKLWSCE
SEIIDEQTFRRSFSDPALSHALDQRVCHDFFQQAAKAVASKGLSIALPLSVAGLSSATLV
NELLEQLENSPLPARLLHLIIPADAIFDHAESVQKLRLAGCRIVFSQVGRDLQIFNSLKA
NMADYLLLDGELCANVQGNLMDEMLITIIQGHAQRLGMKTIAGPVVLPLVMDTLSGIGVD
LIYGDVIANAQPLDLLVNRSYFAIN