Protein Info for EFB2_01785 in Escherichia fergusonii Becca

Annotation: Chaperone protein DnaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00012: HSP70" amino acids 3 to 228 (226 residues), 54.8 bits, see alignment E=5.2e-19 amino acids 330 to 423 (94 residues), 28.5 bits, see alignment E=4.7e-11

Best Hits

Swiss-Prot: 99% identical to YEGD_ECOLI: Uncharacterized chaperone protein YegD (yegD) from Escherichia coli (strain K12)

KEGG orthology group: K04046, hypothetical chaperone protein (inferred from 99% identity to eco:b2069)

Predicted SEED Role

"Putative heat shock protein YegD" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>EFB2_01785 Chaperone protein DnaK (Escherichia fergusonii Becca)
MFIGFDYGTANCSVAVMRDGKPHLLKMENDSTLLPSMLCAPTREAVSEWLYRHHDVPADD
DETQALLRRAIRYNREEDIDVTAKSVQFGLSSLAQYIDDPEEVWFVKSPKSFLGASGLKP
QQVALFEDLVCAMMLHIRQQAQAQLPEAITQAVIGRPINFQGLGGDEANTQAQGILERAA
KRAGFKDVVFQYEPVAAGLDYEATLQEEKRVLVVDIGGGTTDCSLLLMGPQWRSRLDREA
SLLGHSGCRIGGNDLDIALAFKNLMPLLGMGGETEKGIALPILPWWNAVAINDVPAQSDF
YSSANGRLLNDLVRDAREPEKVALLQKVWRQRLSYRLVRSAEESKIALSSVAETRASLPF
ISDELATLISQQGLESALSQPLARILEQVQLALDNAQEKPDVIYLTGGSARSPLIKKALA
EQLPGIPIAGGDDFSSVTAGLARWAEVVFR