Protein Info for ECD_04244 in Escherichia coli BL21

Annotation: ferric iron reductase involved in ferric hydroximate transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 60 to 71 (12 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details TIGR03951: siderophore-iron reductase FhuF" amino acids 87 to 262 (176 residues), 229.6 bits, see alignment E=1.5e-72 PF06276: FhuF" amino acids 93 to 236 (144 residues), 93.7 bits, see alignment E=1.7e-30 PF11575: FhuF_C" amino acids 241 to 261 (21 residues), 28.5 bits, see alignment (E = 1.1e-10)

Best Hits

Swiss-Prot: 100% identical to FHUF_ECOLI: Ferric iron reductase protein FhuF (fhuF) from Escherichia coli (strain K12)

KEGG orthology group: K13255, ferric iron reductase protein FhuF (inferred from 100% identity to eco:b4367)

MetaCyc: 100% identical to ferric-siderophore reductase FhuF (Escherichia coli K-12 substr. MG1655)
1.16.99.-

Predicted SEED Role

"Ferric reductase (1.6.99.14)" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ECD_04244 ferric iron reductase involved in ferric hydroximate transport (Escherichia coli BL21)
MAYRSAPLYEDVIWRTHLQPQDPTLAQAVRATIAKHREHLLEFIRLDEPAPLNAMTLAQW
SSPNVLSSLLAVYSDHIYRNQPMMIRENKPLISLWAQWYIGLMVPPLMLALLTQEKALDV
SPEHFHAEFHETGRVACFWVDVCEDKNATPHSPQHRMETLISQALVPVVQALEATGEING
KLIWSNTGYLINWYLTEMKQLLGEATVESLRHALFFEKTLTNGEDNPLWRTVVLRDGLLV
RRTCCQRYRLPDVQQCGDCTLK