Protein Info for ECD_04235 in Escherichia coli BL21

Annotation: L-galactonate oxidoreductase; L-gulonate oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF08240: ADH_N" amino acids 26 to 134 (109 residues), 98.7 bits, see alignment E=5.3e-32 PF16912: Glu_dehyd_C" amino acids 142 to 338 (197 residues), 39.5 bits, see alignment E=1.1e-13 PF01262: AlaDh_PNT_C" amino acids 165 to 206 (42 residues), 27.9 bits, see alignment 3.8e-10 PF00107: ADH_zinc_N" amino acids 173 to 300 (128 residues), 89.7 bits, see alignment E=4e-29 PF13602: ADH_zinc_N_2" amino acids 215 to 323 (109 residues), 30.4 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 100% identical to LGOD_ECOLI: L-galactonate-5-dehydrogenase (lgoD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4358)

MetaCyc: 100% identical to L-galactonate oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5229 [EC: 1.1.1.414]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.414

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ECD_04235 L-galactonate oxidoreductase; L-gulonate oxidoreductase (Escherichia coli BL21)
MSTMNVLICQQPKELVWKQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIVGLGKNIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLSVPVANILPADGIDPQAAALIEPFAISAHAVRRAAIAPGEQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARREHVATRLELPLLDPSAEDFDAQLRAQFGGSLAQKVIDATGN
QHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA
EGKITADMMLTHRYPFATLAETYERDVINNRELIKGVITF