Protein Info for ECD_04220 in Escherichia coli BL21

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 488 to 507 (20 residues), see Phobius details amino acids 533 to 552 (20 residues), see Phobius details amino acids 565 to 589 (25 residues), see Phobius details amino acids 596 to 616 (21 residues), see Phobius details amino acids 665 to 687 (23 residues), see Phobius details PF02554: CstA" amino acids 35 to 406 (372 residues), 579.8 bits, see alignment E=3.3e-178 amino acids 422 to 614 (193 residues), 233.1 bits, see alignment E=3.5e-73

Best Hits

Swiss-Prot: 100% identical to BTST_ECOLI: Pyruvate/proton symporter BtsT (btsT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_3676)

MetaCyc: 100% identical to pyruvate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (716 amino acids)

>ECD_04220 putative transporter (Escherichia coli BL21)
MDTKKLFKHIPWVILGIIGAFCLAVVALRRGEHVSALWIVVASVSVYLVAYRYYSLYIAQ
KVMKLDPTRATPAVINNDGLNYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTL
WLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKEEMGPVPGTIALFGCFLIMIIILAVL
ALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFIRPGRVGEVSVIGIVLLVASIYFGGV
IAHDPYWGPALTFKDTTITFALIGYAFVSALLPVWLILAPRDYLATFLKIGVIVGLALGI
VVLNPELKMPAMTQYIDGTGPLWKGALFPFLFITIACGAVSGFHALISSGTTPKLLANET
DARFIGYGAMLMESFVAIMALVAASIIEPGLYFAMNTPPAGLGITMPNLHEMGGENAPII
MAQLKDVTAHAAATVSSWGFVISPEQILQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHKV
LPMADMGFWYHFGILFEALFILTALDAGTRSGRFMLQDLLGNFIPFLKKTDSLVAGIIGT
AGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALVLGTVVLIKMKRTQYIWVT
VVPAVWLLICTTWALGLKLFSTNPQMEGFFYMASQYKEKIANGTDLTAQQIANMNHIVVN
NYTNAGLSILFLIVVYSIIFYGFKTWLAVRNSDKRTDKETPYVPIPEGGVKISSHH