Protein Info for ECD_04217 in Escherichia coli BL21

Annotation: methylated adenine and cytosine restriction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF14338: Mrr_N" amino acids 6 to 91 (86 residues), 69.7 bits, see alignment E=2.9e-23 PF04471: Mrr_cat" amino acids 164 to 281 (118 residues), 132.4 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 100% identical to MRR_ECOLI: Mrr restriction system protein (mrr) from Escherichia coli (strain K12)

KEGG orthology group: K07448, restriction system protein (inferred from 100% identity to eco:b4351)

Predicted SEED Role

"Mrr restriction system protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ECD_04217 methylated adenine and cytosine restriction protein (Escherichia coli BL21)
MTVPTYDKFIEPVLRYLATKPEGAAARDVHEAAADALGLDDSQRAKVITSGQLVYKNRAG
WAHDRLKRAGLSQSLSRGKWCLTPAGFDWVASHPQPMTEQETNHLAFDFVNVKLKSRPDA
VDLDPKADSPDHEELAKSSPDDRLDQALKELRDAVADEVLENLLQVSPSRFEVIVLDVLH
RLGYGGHRDDLQRVGGTGDGGIDGVISLDKLGLEKVYVQAKRWQNTVGRPELQAFYGALA
GQKAKRGVFITTSGFTSQARDFAQSVEGMVLVDGERLVHLMIENEVGVSSRLLKVPKLDM
DYFE