Protein Info for ECD_04207 in Escherichia coli BL21

Annotation: putative transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF04754: Transposase_31" amino acids 8 to 210 (203 residues), 291.8 bits, see alignment E=1.3e-91 TIGR01784: conserved hypothetical protein" amino acids 9 to 251 (243 residues), 141.9 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 100% identical to RPND_ECOLU: Recombination-promoting nuclease RpnD (rpnD) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_3691)

MetaCyc: 62% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"FIG00638024: Transposase ECs5301"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>ECD_04207 putative transposase (Escherichia coli BL21)
MTNFTTSTPHDALFKTFLTHPDTARDFMEIHLPKDLRELCDLDSLKLESASFVDEKLRAL
HSDILWSVKTREGDGYIYVVIEHQSREDIHMAFRLMRYSMAVMQRHIEHDKRQPLPLVIP
MLFYHGSRSPYPWSLCWLDEFADPTTARKLYNAAFPLVDVTVVPDDEIVQHRRVALLELI
QKHIRQRDLMGLIDQLVVLLVTECANDSQITALLNYILLTGDEARFNEFISELTRRMPQH
RERIMTIAERIHNDG