Protein Info for ECD_04169 in Escherichia coli BL21

Annotation: putative PTS system EIIC permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 125 to 152 (28 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 290 to 319 (30 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details PF03611: EIIC-GAT" amino acids 4 to 385 (382 residues), 245.6 bits, see alignment E=4.9e-77 TIGR00827: PTS system, galactitol-specific IIC component" amino acids 5 to 410 (406 residues), 704.1 bits, see alignment E=2.7e-216

Best Hits

Swiss-Prot: 100% identical to SGCC_ECOLI: Putative permease IIC component (sgcC) from Escherichia coli (strain K12)

KEGG orthology group: K02775, PTS system, galactitol-specific IIC component (inferred from 100% identity to eco:b4304)

MetaCyc: 100% identical to putative PTS enzyme IIC component SgcC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, galactitol-specific IIC component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>ECD_04169 putative PTS system EIIC permease component (Escherichia coli BL21)
MFDYILSLGGTVFVPIIMIVIGLIFRIPWLQAIKAGVTVGIGFVGMGLVIVMAIDSLSPP
IKVMIERFGLALHVFDVGAGPASGVGYATAIGAMIIPVIFLLNVAMLVTRLTKTMNVDIY
NYWHYAITGTVVQLMTGSLIYGVLGAICHAALSLKMADWTAKRVQNIVGLEGISIPQGYG
SSSVPLFVLLDAIYEKIPFMKGRNIDAQEIQKRYGMVGDPVIIGVVLGLIFGLAAGEGFK
GCASLMITVAAIMVLFPRMIRLIVEGLLPISDGARKFFQKYFKGREVYIGLDTAVTLGHP
TTIAVGLLLIPIMLILASILPGNKVLPLADLPVAPFFICMATVIHRGDLVRTLISGVIVM
ITVLLIATQFAPYFTEMALKGGFSFAGESAQISALSVGNMFGWSISELMSLGIIGVVVAV
GIVASVVLFLRKRELSE