Protein Info for ECD_04149 in Escherichia coli BL21

Annotation: IS600 ORF2-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF13276: HTH_21" amino acids 27 to 83 (57 residues), 50.2 bits, see alignment E=5e-17 PF00665: rve" amino acids 107 to 205 (99 residues), 91.7 bits, see alignment E=6.2e-30 PF13683: rve_3" amino acids 194 to 260 (67 residues), 51.8 bits, see alignment E=1.2e-17 PF13333: rve_2" amino acids 212 to 266 (55 residues), 44.6 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 99% identical to YIS2_SHISO: Insertion element IS600 uncharacterized 31 kDa protein from Shigella sonnei

KEGG orthology group: K07497, putative transposase (inferred from 99% identity to ecs:ECs1311)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>ECD_04149 IS600 ORF2-like protein (Escherichia coli BL21)
MCQVFGVSRSGYYNWVQHEPSDRKQSDERLKLEIKVAHIRTRETYGTRRLQTELAENGII
VGRDRLARLRKELRLRCKQKRKFRATTNSNHNLPVAPNLLNQTFAPTAPNQVWVADLTYV
ATQEGWLYLAGIKDVYTCEIVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQ
YCAYDYRVIQEQFGLKTSMSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIRE
YIEIFYNRQRRHSRLGNISPAAFREKYHQMAA