Protein Info for ECD_04045 in Escherichia coli BL21

Annotation: nitric oxide-sensitive repressor for NO regulon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00738: Rrf2 family protein
  • amino acids 1 to 128 (128 residues), 124 bits, E=1.9e-40
• PF02082: Rrf2
  • amino acids 3 to 130 (128 residues), 127.9 bits, E=1.5e-41

Best Hits

Swiss-Prot: 100% identical to NSRR_ECOSE: HTH-type transcriptional repressor NsrR (nsrR) from Escherichia coli (strain SE11)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 99% identity to eco:b4178)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Protein Sequence (141 amino acids)

>ECD_04045 nitric oxide-sensitive repressor for NO regulon (Escherichia coli BL21)
MQLTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRG
KNGGIRLGKSASAIRIGDVVRELEPLSLVNCSSEFCHITPACRLKQALSKAVQSFLTELD
NYTLADLVEENQPLYKLLLVE