Protein Info for ECD_03982 in Escherichia coli BL21

Annotation: proline/glycine betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 28 to 448 (421 residues), 281.9 bits, see alignment E=2e-87 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 33 to 432 (400 residues), 481.9 bits, see alignment E=8.4e-149 PF07690: MFS_1" amino acids 62 to 309 (248 residues), 86.3 bits, see alignment E=3.9e-28 amino acids 273 to 438 (166 residues), 58.3 bits, see alignment E=1.3e-19 PF13347: MFS_2" amino acids 79 to 403 (325 residues), 30.9 bits, see alignment E=2.3e-11 PF08946: Osmo_CC" amino acids 454 to 499 (46 residues), 86 bits, see alignment 3.5e-28

Best Hits

Swiss-Prot: 100% identical to PROP_ECOLI: Proline/betaine transporter (proP) from Escherichia coli (strain K12)

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to eco:b4111)

MetaCyc: 100% identical to osmolyte:H+ symporter ProP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-29; TRANS-RXN-29A

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>ECD_03982 proline/glycine betaine transporter (Escherichia coli BL21)
MLKRKKVKPITLRDVTIIDDGKLRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGAD
PSVQMVAALATFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYD
TIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGA
GVVVLISTIVGEANFLDWGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDRE
GLQDGPKVSFKEIATKYWRSLLTCIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLM
LAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISVLVAGLTPTLAAWLVESSQNLMMP
AYYLMVVAVVGLITGVTMKETANRPLKGATPAASDIQEAKEILVEHYDNIEQKIDDIDHE
IADLQAKRTRLVQQHPRIDE