Protein Info for ECD_03924 in Escherichia coli BL21

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00772: DnaB" amino acids 27 to 128 (102 residues), 128 bits, see alignment E=2e-41 TIGR00665: replicative DNA helicase" amino acids 27 to 464 (438 residues), 580.7 bits, see alignment E=9.1e-179 PF03796: DnaB_C" amino acids 206 to 462 (257 residues), 361.4 bits, see alignment E=3.6e-112 PF13481: AAA_25" amino acids 223 to 385 (163 residues), 34.5 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 100% identical to DNAB_SHIFL: Replicative DNA helicase (dnaB) from Shigella flexneri

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to eco:b4052)

MetaCyc: 100% identical to replicative DNA helicase (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12 or 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>ECD_03924 replicative DNA helicase (Escherichia coli BL21)
MAGNKPFNKQQAEPRERDPQVAGLKVPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDF
YTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAYLAELSKNTPSAANIS
AYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAESRVFKIAESRANKDEGPK
NIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTTF
AMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGT
MGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRVPALSDNRTLE
IAEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYR
DEVYHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQYDDE