Protein Info for ECD_03812 in Escherichia coli BL21

Annotation: glycerol facilitator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 79 (33 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details PF00230: MIP" amino acids 3 to 251 (249 residues), 237.6 bits, see alignment E=7.2e-75 TIGR00861: MIP family channel proteins" amino acids 13 to 251 (239 residues), 253.4 bits, see alignment E=1e-79

Best Hits

Swiss-Prot: 100% identical to GLPF_ECOL6: Glycerol uptake facilitator protein (glpF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to eco:b3927)

MetaCyc: 100% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ECD_03812 glycerol facilitator (Escherichia coli BL21)
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL