Protein Info for ECD_03799 in Escherichia coli BL21

Annotation: inhibitor of the cpx response; periplasmic adaptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07813: LTXXQ" amino acids 42 to 135 (94 residues), 83.3 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 99% identical to CPXP_ECOL6: Periplasmic protein CpxP (cpxP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06006, periplasmic protein CpxP (inferred from 100% identity to ebr:ECB_03799)

Predicted SEED Role

"P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>ECD_03799 inhibitor of the cpx response; periplasmic adaptor protein (Escherichia coli BL21)
MRIVTAAVMASTLAVSSLSHAAEVGSGDNWYPGEELTQRSMQSHMFDGISLTEHQRQQMR
DLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQM
YRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ