Protein Info for ECD_03791 in Escherichia coli BL21

Annotation: transcriptional activator of rhaBAD and rhaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF02311: AraC_binding" amino acids 16 to 154 (139 residues), 86.8 bits, see alignment E=1.6e-28 PF00165: HTH_AraC" amino acids 180 to 221 (42 residues), 37.5 bits, see alignment 2.9e-13 amino acids 232 to 271 (40 residues), 41.5 bits, see alignment 1.7e-14 PF12833: HTH_18" amino acids 194 to 271 (78 residues), 90.6 bits, see alignment E=9.9e-30

Best Hits

Swiss-Prot: 100% identical to RHAS_ECOLC: HTH-type transcriptional activator RhaS (rhaS) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K02855, AraC family transcriptional regulator, L-rhamnose operon regulatory protein RhaS (inferred from 100% identity to eco:b3905)

Predicted SEED Role

"L-rhamnose operon regulatory protein RhaS" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ECD_03791 transcriptional activator of rhaBAD and rhaT (Escherichia coli BL21)
MTVLHSVDFFPSGNVSVAIEPRLPQADFPEHHHDFHEIVIVEHGTGIHVFNGQPYTITGG
TVCFVRDHDRHLYEHTDNLCLTNVLYRSPDRFQFLAGLNQLLPQELDGQYPSHWRVNHSV
LQQVRQLVAQMEQQEGENDLPSTASREILFMQLLLLLRKSSLQENLENSASRLNLLLAWL
EDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVT
DIAYRCGFSDSNHFSTLFRREFNWSPRDIRQGRDGFLQ