Protein Info for ECD_03761 in Escherichia coli BL21

Annotation: putative sulfoquinovose importer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 16 to 451 (436 residues), 529 bits, see alignment E=4.1e-163 PF13347: MFS_2" amino acids 19 to 437 (419 residues), 265.9 bits, see alignment E=5.4e-83

Best Hits

Swiss-Prot: 98% identical to YIHO_ECOLI: Putative sulfoquinovose importer (yihO) from Escherichia coli (strain K12)

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 100% identity to ebd:ECBD_4151)

MetaCyc: 98% identical to putative sulfoquinovose transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-580

Predicted SEED Role

"Glucuronide transport protein YihO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>ECD_03761 putative sulfoquinovose importer (Escherichia coli BL21)
MSDHNPLTLKLNLWEKIAYGMGDVGSNLMLSIGTLYLLKFYTDELGMPAYYGGIIFLVAK
FFTAFTDMLTGFLLDSRKNIGPKGKFRPFILYAAVPAALIATLQFIATTFSLPVKTTIAT
ALFMMFGLSYSLMNCSYGAMIPAITKNPNERAQLAAYRQGGATIGLLICTVAFIPLQSLF
SDSTVGYACAALMFSIGGFIFMMLCYRGVKEHYVDTAPTGHKASILKSFCAIFRNPPLLV
LCIANLCTLAAFNIKLAIQVYYTQYVLNDINLLSWMGFFSMGCILVGVLLVPLTVKCFGK
KQVYLAGMVLWAVGDILNYFWGSNSFTFVMFSCVAFFGTAFVNSLNWALVPDTVDYGEWK
TGIRAEGSVYTGYTFFRKISAALAGFLPGIMLTQIGYVPNIAQSDATLQGLRQLIFIWPC
ALAIIAALTMGFFYTLNEKRFALIIEEINQRKNKEIETEEKTASVTL