Protein Info for ECD_03598 in Escherichia coli BL21

Annotation: adenine permease, high affinity; adenine:H+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 387 to 412 (26 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 31 to 404 (374 residues), 146.6 bits, see alignment E=4.3e-47

Best Hits

Swiss-Prot: 100% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to ecd:ECDH10B_3901)

MetaCyc: 100% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>ECD_03598 adenine permease, high affinity; adenine:H+ symporter (Escherichia coli BL21)
MSQQHTTQASGQGMLERVFKLREHGTTARTEVIAGFTTFLTMVYIVFVNPQILGVAGMDT
SAVFVTTCLIAAFGSIMMGLFANLPVALAPAMGLNAFFAFVVVQAMGLPWQVGMGAIFWG
AIGLLLLTIFRVRYWMIANIPVSLRVGITSGIGLFIGMMGLKNAGVIVANPETLVSIGNL
TSHSVLLGILGFFIIAILASRNIHAAVLVSIVVTTLLGWMLGDVHYNGIVSAPPSVMTVV
GHVDLAGSFNLGLAGVIFSFMLVNLFDSSGTLIGVTDKAGLADEKGKFPRMKQALYVDSI
SSVTGSFIGTSSVTAYIESSSGVSVGGRTGLTAVVVGLLFLLVIFLSPLAGMVPGYAAAG
ALIYVGVLMTSSLARVNWQDLTESVPAFITAVMMPFSFSITEGIALGFISYCVMKIGTGR
LRDLSPCVIIVALLFILKIVFIDAH