Protein Info for ECD_03495 in Escherichia coli BL21

Annotation: UPF0758 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 15 to 30 (16 residues), see Phobius details amino acids 32 to 32 (1 residues), see Phobius details transmembrane" amino acids 31 to 31 (1 residues), see Phobius details PF20582: UPF0758_N" amino acids 9 to 77 (69 residues), 74 bits, see alignment E=8.4e-25 TIGR00608: DNA repair protein RadC" amino acids 9 to 222 (214 residues), 322.3 bits, see alignment E=8.2e-101 PF04002: RadC" amino acids 103 to 221 (119 residues), 153.1 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 100% identical to YICR_ECOK1: UPF0758 protein YicR (yicR) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 99% identity to ebw:BWG_3329)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ECD_03495 UPF0758 family protein (Escherichia coli BL21)
MKNNAQLLMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLT
SEYEQFSGVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEER
EIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEP
SKADKLITERIIKSCQFMDLRVLDHIVIGRGKYVSFAERGWI