Protein Info for ECD_03491 in Escherichia coli BL21

Annotation: pantetheine-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 157 (154 residues), 206.9 bits, see alignment E=1.7e-65 TIGR00125: cytidyltransferase-like domain" amino acids 4 to 62 (59 residues), 64.5 bits, see alignment E=7.8e-22 PF01467: CTP_transf_like" amino acids 6 to 134 (129 residues), 108.9 bits, see alignment E=2.3e-35 PF08218: Citrate_ly_lig" amino acids 12 to 113 (102 residues), 27.5 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 100% identical to COAD_ECOLI: Phosphopantetheine adenylyltransferase (coaD) from Escherichia coli (strain K12)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 100% identity to eco:b3634)

MetaCyc: 100% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>ECD_03491 pantetheine-phosphate adenylyltransferase (Escherichia coli BL21)
MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMFTLEERVALAQQATA
HLGNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMP
SKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA