Protein Info for ECD_03485 in Escherichia coli BL21

Annotation: IS1 protein InsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF03811: Zn_ribbon_InsA" amino acids 1 to 36 (36 residues), 75.3 bits, see alignment E=2.4e-25 PF12759: HTH_Tnp_IS1" amino acids 43 to 88 (46 residues), 106 bits, see alignment E=5.7e-35

Best Hits

Swiss-Prot: 100% identical to INSA6_ECOLI: Insertion element IS1 6 protein InsA (insA6) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_1569)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (91 amino acids)

>ECD_03485 IS1 protein InsA (Escherichia coli BL21)
MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA
MNGVGCRATARIMGVGLNTILRHLKNSGRSR