Protein Info for ECD_03471 in Escherichia coli BL21

Annotation: activator of AmiB,C murein hydrolases, septal ring factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01551: Peptidase_M23" amino acids 320 to 413 (94 residues), 98.4 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to ENVC_ECOLI: Murein hydrolase activator EnvC (envC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3613)

MetaCyc: 100% identical to murein hydrolase activator EnvC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Periplasmic septal ring factor with murein hydrolase activity EnvC/YibP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ECD_03471 activator of AmiB,C murein hydrolases, septal ring factor (Escherichia coli BL21)
MTRAVKPRRFAIRPIIYASVLSAGVLLCAFSAHADERDQLKSIQADIAAKERAVRQKQQQ
RASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQ
LDAAFRQGEHTGIQLILSGEESQRGQRLQAYFGYLNQARQETIAQLKQTREEVAMQRAEL
EEKQSEQQTLLYEQRAQQAKLTQALNERKKTLAGLESSIQQGQQQLSELRANESRLRNSI
ARAEAAAKARAEREAREAQAVRDRQKEAMRKGTTYKPTESEKSLMSRTGGLGAPRGQAFW
PVRGPTLHRYGEQLQGELRWKGMVIGASEGTEVKAIADGRVILADWLQGYGLVVVVEHGK
GDMSLYGYNQSALVSVGSQVRAGQPIALVGSSGGQGRPSLYFEIRRQGQAVNPQPWLGR