Protein Info for ECD_03465 in Escherichia coli BL21

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF06426: SATase_N" amino acids 9 to 113 (105 residues), 135.2 bits, see alignment E=1e-43 TIGR01172: serine O-acetyltransferase" amino acids 82 to 242 (161 residues), 249.9 bits, see alignment E=5.6e-79 PF00132: Hexapep" amino acids 193 to 226 (34 residues), 38 bits, see alignment 8.8e-14

Best Hits

Swiss-Prot: 100% identical to CYSE_SHIFL: Serine acetyltransferase (cysE) from Shigella flexneri

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 100% identity to eco:b3607)

MetaCyc: 100% identical to serine acetyltransferase (Escherichia coli K-12 substr. MG1655)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ECD_03465 serine acetyltransferase (Escherichia coli BL21)
MSCEELEIVWNNIKAEARTLADCEPMLASFYHATLLKHENLGSALSYMLANKLSSPIMPA
IAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWL
WNQGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSV
TLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVP
ARIVGKPDSDKPSMDMDQHFNGINHTFEYGDGI