Protein Info for ECD_03417 in Escherichia coli BL21

Annotation: D-xylose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR02630: xylose isomerase" amino acids 4 to 437 (434 residues), 731.5 bits, see alignment E=1.7e-224 PF27526: XylA2_C" amino acids 383 to 437 (55 residues), 81.6 bits, see alignment 2e-27

Best Hits

Swiss-Prot: 100% identical to XYLA_ECO45: Xylose isomerase (xylA) from Escherichia coli O45:K1 (strain S88 / ExPEC)

KEGG orthology group: K01805, xylose isomerase [EC: 5.3.1.5] (inferred from 100% identity to eco:b3565)

MetaCyc: 100% identical to xylose isomerase (Escherichia coli K-12 substr. MG1655)
Xylose isomerase. [EC: 5.3.1.5]

Predicted SEED Role

"Xylose isomerase (EC 5.3.1.5)" in subsystem Xylose utilization (EC 5.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ECD_03417 D-xylose isomerase (Escherichia coli BL21)
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHNLSPV
HQSGRQEQLENLVNHYLFDK