Protein Info for ECD_03415 in Escherichia coli BL21

Annotation: YiaAB family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details PF05360: YiaAB" amino acids 6 to 51 (46 residues), 37.2 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 100% identical to YIAB_ECOLI: Inner membrane protein YiaB (yiaB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3563)

Predicted SEED Role

"Inner membrane protein YiaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>ECD_03415 YiaAB family inner membrane protein (Escherichia coli BL21)
MKTSKTVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAYLRAEKLGQLD
DFFTHICQLVALITIGLLFIGVLNAPINTYEMVIYPIAFFVCLFGQMRLFRSA