Protein Info for ECD_03414 in Escherichia coli BL21

Annotation: YiaAB family inner membrane protein, tandem domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details PF05360: YiaAB" amino acids 12 to 64 (53 residues), 74.1 bits, see alignment E=4.2e-25 amino acids 75 to 127 (53 residues), 68.3 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 100% identical to YIAA_SHIFL: Inner membrane protein YiaA (yiaA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b3562)

Predicted SEED Role

"Inner membrane protein YiaA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>ECD_03414 YiaAB family inner membrane protein, tandem domains (Escherichia coli BL21)
MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK
TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA
VQKNIRDAGINPPKETQVTQEEYSE