Protein Info for ECD_03351 in Escherichia coli BL21

Annotation: arsenite/antimonite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 51 to 70 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 401 to 425 (25 residues), see Phobius details PF02040: ArsB" amino acids 3 to 423 (421 residues), 532.3 bits, see alignment E=1.2e-163 TIGR00935: arsenite/antimonite efflux pump membrane protein" amino acids 3 to 426 (424 residues), 728.9 bits, see alignment E=1.2e-223 PF03600: CitMHS" amino acids 12 to 368 (357 residues), 206 bits, see alignment E=8.8e-65

Best Hits

Swiss-Prot: 100% identical to ARSB_ECO57: Arsenical pump membrane protein (arsB) from Escherichia coli O157:H7

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 100% identity to eco:b3502)

MetaCyc: 100% identical to arsenite/antimonite:H+ antiporter (Escherichia coli K-12 substr. MG1655)
RXN-22385; RXN3O-9786

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ECD_03351 arsenite/antimonite transporter (Escherichia coli BL21)
MLLAGAIFVLTIVLVIWQPKGLGIGWSATLGAVLALVTGVVHPGDIPVVWNIVWNATAAF
IAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTWIVLLGAAVAALFANDGAALILTP
IVIAMLLALGFSKGTTLAFVMAAGFIADTASLPLIVSNLVNIVSADFFGLGFREYASVMV
PVDIAAIVATLVMLHLYFRKDIPQNYDMALLKSPAEAIKDPATFKTGWVVLLLLLVGFFV
LEPLGIPVSAIAAVGALILFVVAKRGHAINTGKVLRGAPWQIVIFSLGMYLVVYGLRNAG
LTEYLSGVLNVLADNGLWAATLGTGFLTAFLSSIMNNMPTVLVGALSIDGSTASGVIKEA
MVYANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTISWGYYFRTGIIMTLPVLFVTLAA
LALRLSFTL