Protein Info for ECD_03341 in Escherichia coli BL21

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03486: HI0933_like" amino acids 5 to 392 (388 residues), 320.5 bits, see alignment E=2.8e-99 PF07992: Pyr_redox_2" amino acids 5 to 162 (158 residues), 34.5 bits, see alignment E=6.3e-12 PF00890: FAD_binding_2" amino acids 5 to 48 (44 residues), 25.6 bits, see alignment 2.9e-09 TIGR00275: flavoprotein, HI0933 family" amino acids 7 to 392 (386 residues), 426.9 bits, see alignment E=3.7e-132 PF13450: NAD_binding_8" amino acids 8 to 39 (32 residues), 23.6 bits, see alignment (E = 2.1e-08) PF22780: HI0933_like_1st" amino acids 188 to 339 (152 residues), 167.9 bits, see alignment E=6.8e-53

Best Hits

Swiss-Prot: 100% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 100% identity to eco:b3492)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ECD_03341 putative oxidoreductase (Escherichia coli BL21)
MERFDAIIIGAGAAGMFCSALAGQAGRRVLLIDNGKKPGRKILMSGGGRCNFTNLYVEPG
AYLSQNPHFCKSALARFTQWDFIDLVNKHGIAWHEKTLGQLFCDDSAQQIVNMLVDECEK
GNVTFRLRSEVLSVAKDETGFTLDLNGMTVGCEKLVIATGGLSMPGLGASPFGYKIAEQF
GLNVLPTRAGLVPFTLHKPLLEELQVLAGVAVPSVITAENGTVFRENLLFTHRGLSGPAV
LQISSYWQPGEFVSINLLPDVDLETFLNEQRNAHPNQSLKNTLAVHLPKRLVERLQQLGQ
IPDVSLKQLNVRDQQALISTLTDWRVQPNGTEGYRTAEVTLGGVDTNELSSRTMEARKVP
GLYFIGEVMDVTGWLGGYNFQWAWSSAWACAQDLIAAKSS