Protein Info for ECD_03222 in Escherichia coli BL21

Annotation: fructoselysine-6-P-deglycase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 43 to 160 (118 residues), 34.3 bits, E=9.5e-13

Best Hits

Swiss-Prot: 100% identical to FRLB_SHIFL: Fructoselysine 6-phosphate deglycase (frlB) from Shigella flexneri

KEGG orthology group: K10708, fructoselysine 6-phosphate deglycase [EC: 3.5.-.-] (inferred from 100% identity to eco:b3371)

MetaCyc: 100% identical to fructoselysine 6-phosphate deglycase (Escherichia coli K-12 substr. MG1655)
RXN0-963

Predicted SEED Role

"Fructoselysine 6-phosphate deglycase (EC 3.5.-.-)" (EC 3.5.-.-)

MetaCyc Pathways

• fructoselysine and psicoselysine degradation (3/3 steps found)
• fructosyllysine and glucosyllysine metabolism (5/6 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.5.-.-

Use Curated BLAST to search for 3.5.-.-

Protein Sequence (340 amino acids)

>ECD_03222 fructoselysine-6-P-deglycase (Escherichia coli BL21)
MLDIDKSTVDFLVTENMVQEVEKVLSHDVPLVHAIVEEMVKRDIDRIYFVACGSPLNAAQ
TAKHLADRFSDLQVYAISGWEFCDNTPYRLDDRCAVIGVSDYGKTEEVIKALELGRACGA
LTAAFTKRADSPITSAAEFSIDYQADCIWEIHLLLCYSVVLEMITRLAPNAEIGKIKNDL
KQLPNALGHLVRTWEEKGRQLGELASQWPMIYTVAAGPLRPLGYKEGIVTLMEFTWTHGC
VIESGEFRHGPLEIVEPGVPFLFLLGNDESRHTTERAINFVKQRTDNVIVIDYAEISQGL
HPWLAPFLMFVPMEWLCYYLSIYKDHNPDERRYYGGLVEY