Protein Info for ECD_03214 in Escherichia coli BL21

Annotation: peptidyl-prolyl cis-trans isomerase A (rotamase A)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00160: Pro_isomerase" amino acids 31 to 188 (158 residues), 173.4 bits, see alignment E=2.3e-55

Best Hits

Swiss-Prot: 100% identical to PPIA_ECOL6: Peptidyl-prolyl cis-trans isomerase A (ppiA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03767, peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC: 5.2.1.8] (inferred from 100% identity to eco:b3363)

MetaCyc: 100% identical to peptidyl-prolyl cis-trans isomerase A (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiA precursor (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>ECD_03214 peptidyl-prolyl cis-trans isomerase A (rotamase A) (Escherichia coli BL21)
MFKSTLAAMAAVFALSALSPAAMAAKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVNYV
NSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADK
DSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKP
VVILSAKVLP